nelk831 nelk831

03-11-2020
Mathematics

contestada

Complete the equation.
5x + 5x = 10x

Complete the equation 5x 5x 10x class=

Respuesta :

quhana09 quhana09

03-11-2020

Answer:

10x2

Step-by-step explanation:

jfdcwfghngkkgfffddnmkhcfhgfegvchnujffghjj

Answer Link

eekram512 eekram512

03-11-2020

Answer:

may be 1

Step-by-step explanation:

5x+5x=10x

so the answer must be 1

Answer Link

Otras preguntas

The cell spends most of its time in the ........blank......... stage of the cell cycle?

When European countries set up empires of colonies in Africa and Asia, they were practicing?

Which of the classifications for humans means that we have a hollow nerve chord? A) Class B) Kingdom C) Order D) Phylum

What is the total surace area of the cylinder? Write your answer as a polynomial in standard form.

what does it mean to alter a landscape?

Supporters of the spoils system claimed it made government more efficient because like-minded individuals cooperated. Opponents claimed it made government less

Jacob wants to eat 28 servings of protein each week. He eats 4 servings each day. After 3 days,how many servings of protein does Jacob have left to eat in orde

• Machine s is cleaned every 12 weeks. •Machine that is cleaned every 8 weeks. What is the fewest number of weeks that will pass before both machines are cleane

use an inch ruler, What is the length to the nearest inch

how do you know how big or important a city is